PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G1605
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 296aa    MW: 33856.3 Da    PI: 6.4187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G1605genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.9e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l + +   G  +W+++++  g+ R++k+c++rw +yl
      Gh_A07G1605 14 KGPWTAEEDKKLFNFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.42.6e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
      Gh_A07G1605  71 SEYEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-20563IPR009057Homeodomain-like
PROSITE profilePS5129412.918961IPR017930Myb domain
SuperFamilySSF466891.05E-2611108IPR009057Homeodomain-like
SMARTSM007174.9E-121363IPR001005SANT/Myb domain
PfamPF002498.9E-141461IPR001005SANT/Myb domain
CDDcd001671.72E-81661No hitNo description
PROSITE profilePS5129425.60962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2464116IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002494.2E-1471111IPR001005SANT/Myb domain
CDDcd001678.73E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLFNFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPLTHKPLT TTQEHHPQQQ QDKQKKQAPK PGDARSQAPK EPEAETSLKS TITEAKEEEP  180
MNNIGIDGFC TDEVPLIESH EILVPNPAPS ISSSSSSSCH SSMFLEELQF SDFEWPCDDY  240
NTSNKELSLW DDDFNIWDFL SNDDTDKKLA LDSLSSPLMQ CPRMGFDQDS RPYQLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141146DKQKKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707891e-128AB970789.1 Populus nigra PniMYB152 mRNA for MYB transcriptional factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488073.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX61e-84ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B0MTU50.0A0A0B0MTU5_G
STRINGVIT_14s0006g00450.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-97myb domain protein 20